CDK9/CyclinK Kinase Enzyme System

Kinase Enzyme Systems for Detecting Kinase Activity
customize-this-small
View information on global supply logistics

Easily Screen and Profile CDK9/CyclinK Kinase Inhibitors

  • Includes kinase, substrate and reaction buffer
  • Use with ADP-Glo™ Assay for bioluminescent detection of kinase activity

Size

Additional options

Catalog number selected: V4104

$ 575.00
Your price:
Add to Cart
This product is discontinued
This product is available under our Early Access program - Learn More
This product is available under our Catalog (FT) program - Learn More
CDK9/CyclinK Kinase Enzyme System
10µg
$ 575.00
Your price: Log in
Change Configuration

Convenient, Scalable Kinase Profiling

The Kinase Enzyme Systems include a recombinant kinase enzyme, a substrate appropriate for the enzyme, a reaction buffer and supplemental reagents as needed. The CDK9/CyclinK Kinase Enzyme System contains:

  • CDK9/CyclinK Kinase, 10μg (Human, recombinant full-length). MW: ~68kDa (CDK9) and ~67kDa (CyclinK).
  • PDKtide ([protein fragment, 39 aa]) Substrate; residues 1–14 are derived from AKT1 (307–320), and residues 16–39 are derived from PKN2/PRK2 (961–984).
  • Reaction Buffer, DTT.

Recombinant full-length human CDK9 and CyclinK proteins were co-expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. CDK9/CyclinK is a member of the cyclin-dependent protein kinase (CDK) family. CDK9 is closely related to cdc28 and cdc2 and is an important regulator of the cell cycle. CDK9 is a component of the multiprotein complex TAK/P-TEFβ. CDK9 can modulate RNA polymerase II-directed transcription by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II. CDK9 forms a complex with and is regulated by its regulatory subunit cyclin T or cyclin K. CDK9 also interacts with the HIV-1 Tat protein, which suggests a possible involvement of this protein in AIDS.

CDK9/CyclinK NCBI Database Entry.

The CDK9/CyclinK Kinase Enzyme System can be purchased with or without the ADP-Glo™ Kinase Assay reagents. Used together, the ADP-Glo™ Kinase Assay + Kinase Enzyme Systems provide a convenient method for profiling the effect of lead compounds on kinase activity. Assay advantages include broad dynamic range, ease of use and high sensitivity. Kinase Enzyme Systems are manufactured by SignalChem. Bulk quantities available upon request.

Use with ADP-Glo™ Kinase Assay

The ADP-Glo™ Kinase Assay is a luminescent kinase assay that measures ADP formed from a kinase reaction; ADP is converted into ATP, which is a substrate in a reaction catalyzed by Ultra-Glo™ Luciferase that produces light. The luminescent signal positively correlates with ADP amount and kinase activity. The assay is well suited for measuring the effects of chemical compounds on the activity of a broad range of purified kinases, making it ideal for both primary screening as well as kinase selectivity profiling. The ADP-Glo™ Kinase Assay can be used to monitor the activity of virtually any ADP-generating enzyme (e.g., kinase or ATPase) using up to 1mM ATP.

 

See all Kinase Enzyme Systems available from Promega.

Specifications

You are viewing: V4104 Change Configuration

Certificate of Analysis

Search by lot number

Use Restrictions

For Research Use Only. Not for Use in Diagnostic Procedures.

Storage Conditions

AA

Specifications

You are viewing: V6283 Change Configuration

Certificate of Analysis

Search by lot number

Use Restrictions

For Research Use Only. Not for Use in Diagnostic Procedures.

Storage Conditions

AA

Specifications

You are viewing: V4105 Change Configuration

What's in the box?

Item Part # Size
CDK9/CyclinK Kinase Enzyme System V4104 1 × 10μg

ADP-Glo™ Kinase Assay

V9101 1 × 1,000 assays

Certificate of Analysis

Search by lot number

Use Restrictions

For Research Use Only. Not for Use in Diagnostic Procedures.

Storage Conditions

Patents and Disclaimers

U.S. Pat. Nos. 7,741,067 and 8,361,739.

U.S. Pat. No. 7,700,310 and other patents and patents pending.

U.S. Pat. No. 8,183,007 and other patents and patents pending.

Let's find the product that meets your needs.

Talk to a Scientist

Maria

Maria

Spain